PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10032226
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 304aa    MW: 33812.9 Da    PI: 5.0255
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10032226genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.88.1e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l++ +   G  +W+++++  g++R++k+c++rw +yl
      Lus10032226 14 KGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding506.9e-1673111747
                      HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
      Lus10032226  73 AEEQLVIDLHARLGNR-WSKIAAKLP-GRTDNEIKNHWNTH 111
                      69**************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.3E-21562IPR009057Homeodomain-like
PROSITE profilePS5129414.027961IPR017930Myb domain
SuperFamilySSF466894.49E-2611108IPR009057Homeodomain-like
SMARTSM007178.5E-131363IPR001005SANT/Myb domain
PfamPF002499.9E-151461IPR001005SANT/Myb domain
CDDcd001672.72E-91661No hitNo description
PROSITE profilePS5129426.24862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2363116IPR009057Homeodomain-like
SMARTSM007175.3E-1466114IPR001005SANT/Myb domain
PfamPF002497.9E-1473111IPR001005SANT/Myb domain
CDDcd001678.42E-1174112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTAE EDKKLINFIL TNGQCCWRAV PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL NDAEEQLVID LHARLGNRWS KIAAKLPGRT DNEIKNHWNT HIKKKLLKMG  120
IDPVTHEPLN KSDNDHDQTS NSPDHQEPIL SPQSQQQPLA NHDNEEALLI NSKTENSSSN  180
DSSSSSSLSS SSSSSILLDN ICNDDALLNS LWMVDQPLLV DSFINPTPSS LITTPNTTTI  240
CNSTSTNAIG TNWYPSWEDS CSWLLDCQDF GVHDFGFEDI DLTAIGSLVM EDNPVVVNEM  300
LQQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007039958.11e-121Myb domain protein 42
SwissprotQ50EX61e-108ODO1_PETHY; Protein ODORANT1
TrEMBLA0A061GBM81e-121A0A061GBM8_THECC; Myb domain protein 42
STRINGPOPTR_0001s07830.11e-120(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12350.12e-90myb domain protein 42